β-Defensin-3, human
Price range: $272.00 through $1,632.00
β-Defensin-3, human
β-Defensin-3, human is a 78-amino-acid A peptide related to the cathelicidin/LL-37 family of host defense peptides (antimicrobial peptides, AMPs). These peptides exhibit broad-spectrum antimicrobial activity against bacteria, fungi, and viruses, and modulate innate immune responses including chemotaxis, cytokine production, and wound healing. Used in infectious disease and immunology research for studying antimicrobial mechanisms and immune modulation.
Product Specifications
| Molecular Weight | 5155.0992 Da |
| Molecular Formula | C₂₁₆H₃₇₁N₇₅O₅₉S₆ |
| Purity | Peak Area by HPLC ≥95% |
| Form | Lyophilized |
| Storage | -20°C |
| Usage | Research use |
Amino Acid Sequence
One-Letter Code:
GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK(Disulfidebridge:Cys11-Cys40,Cys18-Cys33,Cys23-Cys41)
Three-Letter Code:
H-Gly-Ile-Ile-Asn-Thr-Leu-Gln-Lys-Tyr-Tyr-Cys-Arg-Val-Arg-Gly-Gly-Arg-Cys-Ala-Val-Leu-Ser-Cys-Leu-Pro-Lys-Glu-Glu-Gln-Ile-Gly-Lys-Cys-Ser-Thr-Arg-Gly-Arg-Lys-Cys-Cys-Arg-Arg-Lys-Lys-OH(Disulfidebridge:Cys11-Cys40,Cys18-Cys33,Cys23-Cys41)
Research Applications
- Application: Antimicrobial activity
- Biomarker Target: Host Defense Peptide
- Research Area: Immunology
- Sub-category: Antimicrobial Peptides & Innate Immunity
Reconstitution & Storage
- Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
- Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
- Stability: Lyophilized product is stable for 24 months when stored properly.
For research use only. Not for diagnostic or therapeutic use.
Safety Data Sheets & Documentation
Protocols & Support
Reconstitution Protocol
1. Briefly centrifuge the vial to collect lyophilized powder at the bottom.
2. Reconstitute in sterile deionized water or PBS to a concentration of 0.2–1.0 mg/mL.
3. Gently pipette up and down to dissolve. Do not vortex.
4. Aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
Download Data Sheet
Complete product data sheet including batch-specific QC data, sequence information, and storage guidelines.
Download PDF Data Sheet