Aldosterone Secretion Inhibiting Factor (1-35) (bovine)

Aldosterone Secretion Inhibiting Factor (1-35) (bovine)

Aldosterone Secretion Inhibiting Factor (1-35) (bovine) is a 56-amino-acid synthetic peptide. A synthetic peptide used as a research tool in biochemistry, pharmacology, and biomedical research. This peptide enables the study of protein-protein interactions, receptor binding, enzyme substrate specificity, and signal transduction pathways. Available in high purity (≥95% by HPLC) as a lyophilized powder for reconstitution in appropriate buffers.

Product Specifications

Amino Acid Sequence

One-Letter Code:

ALRGPKMMRDSGCFGRRLDRIGSLSGLGCNVLRRY(Disulfidebridge:Cys13-Cys29)

Three-Letter Code:

H-Ala-Leu-Arg-Gly-Pro-Lys-Met-Met-Arg-Asp-Ser-Gly-Cys-Phe-Gly-Arg-Arg-Leu-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Leu-Gly-Cys-Asn-Val-Leu-Arg-Arg-Tyr-OH(Disulfidebridge:Cys13-Cys29)

Research Applications

• Application: Receptor binding
• Biomarker Target: Disulfide-bonded Target
• Research Area: Pharmacology
• Sub-category: Receptor Ligands & Peptide Drugs

Reconstitution & Storage

• Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
• Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Lyophilized product is stable for 24 months when stored properly.

For research use only. Not for diagnostic or therapeutic use.

Safety Data Sheets & Documentation

Protocols & Support