PACAP(1-38)-Lys(Biotin), amide, human, ovine, rat

In Stock · Ships Today
SKU: BPT1818

Price range: $319.60 through $1,917.60

Size
SKU: BPT1818-1MG $319.60
Quality guaranteed
Ships within 24 hours

PACAP(1-38)-Lys(Biotin), amide, human, ovine, rat

PACAP(1-38)-Lys(Biotin), amide, human, ovine, rat is a 49-amino-acid A peptide related to the vasoactive intestinal peptide (VIP) / PACAP family, a 28-amino-acid neuropeptide that signals through VPAC1 and VPAC2 receptors. VIP mediates vasodilation, smooth muscle relaxation, exocrine secretion, immune modulation, and circadian rhythm regulation. Used in immunology, neuroscience, and gastrointestinal research.

Product Specifications

Molecular Weight 4888.7089 Da
Molecular Formula C₂₁₉H₃₅₇N₆₇O₅₆S₂
Purity Peak Area by HPLC ≥95%
Form Lyophilized
Storage -20°C
Usage Research use

Amino Acid Sequence

One-Letter Code:

HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK{Lys(Biotin)}-NH2

Three-Letter Code:

H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-{Lys(Biotin)}-NH2

Research Applications

  • Application: Receptor binding
  • Biomarker Target: VIP/PACAP Receptors (VPAC1/2)
  • Research Area: Neuroscience
  • Sub-category: VIP/PACAP Signaling

Reconstitution & Storage

  • Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
  • Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
  • Stability: Lyophilized product is stable for 24 months when stored properly.

For research use only. Not for diagnostic or therapeutic use.

PACAP(1-38)-Lys(Biotin), amide, human, ovine, rat is a 49-amino-acid A peptide related to the vasoactive intestinal peptide (VIP) / PACAP family, a 28-amino-acid neuropeptide that signals through VPAC1 and VPAC2 receptors. VIP mediates vasodilation, smooth muscle relaxation, exocrine secretion, i...

Safety Data Sheets & Documentation

Safety Data Sheet (SDS) PDF — BPT1818

Protocols & Support

Reconstitution Protocol

1. Briefly centrifuge the vial to collect lyophilized powder at the bottom.

2. Reconstitute in sterile deionized water or PBS to a concentration of 0.2–1.0 mg/mL.

3. Gently pipette up and down to dissolve. Do not vortex.

4. Aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.

Download Data Sheet

Complete product data sheet including batch-specific QC data, sequence information, and storage guidelines.

Download PDF Data Sheet