Name: Galanin (1-29) (rat, mouse)
Brand: Boston Molecules
SKU: BPT1898
Price: 272.00 USD
Availability: InStock

Galanin (1-29) (rat, mouse)

Galanin (1-29) (rat, mouse) is a 31-amino-acid A peptide from the galanin family, a neuropeptide widely expressed in the central and peripheral nervous systems. Galanin modulates neurotransmitter release (including acetylcholine, serotonin, and norepinephrine) through GalR1, GalR2, and GalR3 receptors, influencing cognition, pain, feeding, mood, and neuroendocrine function. Used in neuroscience research for studying neuropeptide signaling, Alzheimer’s disease, epilepsy, and depression.

Product Specifications

CAS Number	114547-31-8
Molecular Weight	3164.4391 Da
Molecular Formula	C₁₄₁H₂₁₁N₄₃O₄₁
Purity	Peak Area by HPLC ≥95%
Form	Lyophilized
Storage	-20°C
Usage	Research use

Amino Acid Sequence

One-Letter Code:

GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2

Three-Letter Code:

H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2

Research Applications

Application: Receptor binding
Biomarker Target: Galanin Receptors (GalR1-3)
Research Area: Neuroscience
Sub-category: Galanin & Neuromodulation

Reconstitution & Storage

Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
Stability: Lyophilized product is stable for 24 months when stored properly.

For research use only. Not for diagnostic or therapeutic use.

Galanin (1-29) (rat, mouse) is a 31-amino-acid A peptide from the galanin family, a neuropeptide widely expressed in the central and peripheral nervous systems. Galanin modulates neurotransmitter release (including acetylcholine, serotonin, and norepinephrine) through GalR1, GalR2, and GalR3 rece...