Secretoneurin (mouse,rat)

In Stock · Ships Today
SKU: BPT2368

Price range: $306.00 through $1,836.00

Size
SKU: BPT2368-1MG $306.00
Quality guaranteed
Ships within 24 hours

Secretoneurin (mouse,rat)

Secretoneurin (mouse,rat) is a 33-amino-acid synthetic peptide. A synthetic peptide used as a research tool in biochemistry, pharmacology, and biomedical research. This peptide enables the study of protein-protein interactions, receptor binding, enzyme substrate specificity, and signal transduction pathways. Available in high purity (≥95% by HPLC) as a lyophilized powder for reconstitution in appropriate buffers.

Product Specifications

CAS Number 149146-12-3
Molecular Weight 3651.9253 Da
Molecular Formula C₁₅₉H₂₅₂N₄₀O₅₈
Purity Peak Area by HPLC ≥95%
Form Lyophilized
Storage -20°C
Usage Research use

Amino Acid Sequence

One-Letter Code:

TNEIVEEQYTPQSLATLESVFQELGKLTGPNSQ

Three-Letter Code:

H-Thr-Asn-Glu-Ile-Val-Glu-Glu-Gln-Tyr-Thr-Pro-Gln-Ser-Leu-Ala-Thr-Leu-Glu-Ser-Val-Phe-Gln-Glu-Leu-Gly-Lys-Leu-Thr-Gly-Pro-Asn-Ser-Gln-OH

Research Applications

  • Application: Biological activity
  • Biomarker Target: Peptide Target
  • Research Area: Biomedical Research
  • Sub-category: Research Peptides & Tools

Reconstitution & Storage

  • Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
  • Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
  • Stability: Lyophilized product is stable for 24 months when stored properly.

For research use only. Not for diagnostic or therapeutic use.

Secretoneurin (mouse,rat) is a 33-amino-acid synthetic peptide. A synthetic peptide used as a research tool in biochemistry, pharmacology, and biomedical research.

Safety Data Sheets & Documentation

Safety Data Sheet (SDS) PDF — BPT2368

Protocols & Support

Reconstitution Protocol

1. Briefly centrifuge the vial to collect lyophilized powder at the bottom.

2. Reconstitute in sterile deionized water or PBS to a concentration of 0.2–1.0 mg/mL.

3. Gently pipette up and down to dissolve. Do not vortex.

4. Aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.

Download Data Sheet

Complete product data sheet including batch-specific QC data, sequence information, and storage guidelines.

Download PDF Data Sheet