Calcitonin, rat
Price range: $206.55 through $1,239.30
Calcitonin, rat
Calcitonin, rat is a 55-amino-acid A peptide related to the calcitonin/CGRP superfamily, involved in calcium homeostasis, bone metabolism, vasodilation, and nociception. Used in endocrinology and neuroscience research to study calcitonin receptor (CTR) and CGRP receptor (CLR/RAMP1) signaling, with applications in osteoporosis, migraine, and pain research.
Product Specifications
| CAS Number | 11118-25-5 |
| Molecular Weight | 3399.8202 Da |
| Molecular Formula | C₁₄₈H₂₂₈N₄₀O₄₆S₃ |
| Purity | Peak Area by HPLC ≥95% |
| Form | Lyophilized |
| Storage | -20°C |
| Usage | Research use |
Amino Acid Sequence
One-Letter Code:
CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP-NH2(Disulfidebridge:Cys1-Cys7)
Three-Letter Code:
H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Leu-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ser-Ile-Gly-Val-Gly-Ala-Pro-NH2(Disulfidebridge:Cys1-Cys7)
Research Applications
- Application: Receptor binding
- Biomarker Target: Calcitonin/CGRP Receptors
- Research Area: Endocrinology
- Sub-category: Calcitonin/CGRP & Bone Metabolism
Reconstitution & Storage
- Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
- Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
- Stability: Lyophilized product is stable for 24 months when stored properly.
For research use only. Not for diagnostic or therapeutic use.
Safety Data Sheets & Documentation
Protocols & Support
Reconstitution Protocol
1. Briefly centrifuge the vial to collect lyophilized powder at the bottom.
2. Reconstitute in sterile deionized water or PBS to a concentration of 0.2–1.0 mg/mL.
3. Gently pipette up and down to dissolve. Do not vortex.
4. Aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
Download Data Sheet
Complete product data sheet including batch-specific QC data, sequence information, and storage guidelines.
Download PDF Data Sheet