Gastrin Releasing Peptide, procine
Price range: $137.70 through $826.20
Gastrin Releasing Peptide, procine
Gastrin Releasing Peptide, procine is a 29-amino-acid A peptide related to the bombesin/gastrin-releasing peptide (GRP) family, which mediates diverse physiological functions including gastrointestinal motility, hormone secretion, cell proliferation, and satiety signaling. This peptide is used in oncology and gastrointestinal research to study GRP receptor (GRPR/BB2) signaling, tumor growth, and the development of targeted diagnostic and therapeutic agents.
Product Specifications
| CAS Number | 74815-57-9 |
| Molecular Weight | 2805.2784 Da |
| Molecular Formula | C₁₂₆H₁₉₈N₃₈O₃₁S₂ |
| Purity | Peak Area by HPLC ≥95% |
| Form | Lyophilized |
| Storage | -20°C |
| Usage | Research use |
Amino Acid Sequence
One-Letter Code:
APVSVGGGTVLAKMYPRGNHWAVGHLM-NH2
Three-Letter Code:
H-Ala-Pro-Val-Ser-Val-Gly-Gly-Gly-Thr-Val-Leu-Ala-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2
Research Applications
- Application: Receptor binding
- Biomarker Target: Bombesin/GRP Receptors (BB1-3)
- Research Area: Oncology
- Sub-category: Bombesin/GRP Signaling & Tumor Biology
Reconstitution & Storage
- Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
- Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
- Stability: Lyophilized product is stable for 24 months when stored properly.
For research use only. Not for diagnostic or therapeutic use.
Safety Data Sheets & Documentation
Protocols & Support
Reconstitution Protocol
1. Briefly centrifuge the vial to collect lyophilized powder at the bottom.
2. Reconstitute in sterile deionized water or PBS to a concentration of 0.2–1.0 mg/mL.
3. Gently pipette up and down to dissolve. Do not vortex.
4. Aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
Download Data Sheet
Complete product data sheet including batch-specific QC data, sequence information, and storage guidelines.
Download PDF Data Sheet
