Name: LL-37(human)
Brand: Boston Molecules
SKU: BPT2728
Price: 209.95 USD
Availability: InStock

LL-37(human)

LL-37(human) — A peptide related to the cathelicidin/LL-37 family of host defense peptides (antimicrobial peptides, AMPs). These peptides exhibit broad-spectrum antimicrobial activity against bacteria, fungi, and viruses, and modulate innate immune responses including chemotaxis, cytokine production, and wound healing. Used in infectious disease and immunology research for studying antimicrobial mechanisms and immune modulation.

Product Specifications

CAS Number	597562-32-8
Molecular Weight	4493.31 Da
Molecular Formula	C205H340N60O53
Purity	Peak Area by HPLC ≥95%
Form	Lyophilized
Storage	-20°C
Usage	Research use

Amino Acid Sequence

One-Letter Code:

[LL-37, 37 aa]

Three-Letter Code:

Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser

Research Applications

Application: Antimicrobial activity
Biomarker Target: Host Defense Peptide
Research Area: Immunology
Sub-category: Antimicrobial Peptides & Innate Immunity

Reconstitution & Storage

Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
Stability: Lyophilized product is stable for 24 months when stored properly.

For research use only. Not for diagnostic or therapeutic use.

LL-37(human) — A peptide related to the cathelicidin/LL-37 family of host defense peptides (antimicrobial peptides, AMPs). These peptides exhibit broad-spectrum antimicrobial activity against bacteria, fungi, and viruses, and modulate innate immune responses including chemotaxis, cytokine product...