β-Amyloid (1-38), mouse, rat

In Stock · Ships Today
SKU: BPT0160

Price range: $338.40 through $2,030.40

Size
SKU: BPT0160-1MG $338.40
Quality guaranteed
Ships within 24 hours

β-Amyloid (1-38), mouse, rat

β-Amyloid (1-38), mouse, rat is a 38-amino-acid A synthetic peptide fragment of the amyloid β-protein (Aβ), a 39–43 amino acid peptide that is the principal component of amyloid plaques in Alzheimer’s disease. This fragment is widely used in neuroscience research to study Aβ aggregation, neurotoxicity, and the molecular mechanisms underlying Alzheimer’s pathology. It serves as a valuable tool for investigating amyloid fibril formation, screening potential therapeutic agents, and elucidating structure-activity relationships within the Aβ sequence.

Product Specifications

CAS Number 186359-66-0
Molecular Weight 4035.443 Da
Molecular Formula C₁₈₀H₂₇₃N₄₉O₅₅S₁
Purity Peak Area by HPLC ≥95%
Form Lyophilized
Storage -20°C
Usage Research use

Amino Acid Sequence

One-Letter Code:

DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGG

Three-Letter Code:

H-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-OH

Research Applications

  • Application: Neurotoxicity & Aggregation
  • Biomarker Target: Amyloid-β / Tau
  • Research Area: Neuroscience
  • Sub-category: Neurodegeneration & Alzheimer’s Disease

Reconstitution & Storage

  • Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
  • Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
  • Stability: Lyophilized product is stable for 24 months when stored properly.

For research use only. Not for diagnostic or therapeutic use.

β-Amyloid (1-38), mouse, rat is a 38-amino-acid A synthetic peptide fragment of the amyloid β-protein (Aβ), a 39–43 amino acid peptide that is the principal component of amyloid plaques in Alzheimer's disease. This fragment is widely used in neuroscience research to study Aβ aggregation, neurotox...

Safety Data Sheets & Documentation

Safety Data Sheet (SDS) PDF — BPT0160

Protocols & Support

Reconstitution Protocol

1. Briefly centrifuge the vial to collect lyophilized powder at the bottom.

2. Reconstitute in sterile deionized water or PBS to a concentration of 0.2–1.0 mg/mL.

3. Gently pipette up and down to dissolve. Do not vortex.

4. Aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.

Download Data Sheet

Complete product data sheet including batch-specific QC data, sequence information, and storage guidelines.

Download PDF Data Sheet