β-Endorphin,human

In Stock · Ships Today
SKU: BPT1558

Price range: $272.00 through $1,632.00

Size
SKU: BPT1558-1MG $272.00
Quality guaranteed
Ships within 24 hours

β-Endorphin,human

β-Endorphin,human is a 31-amino-acid An endogenous opioid peptide involved in pain modulation, stress response, and reward signaling. Endorphins bind predominantly to μ-opioid receptors (MOR) and play critical roles in analgesia, euphoria, and neuroendocrine regulation. Used in neuroscience and pharmacology research for studying opioid receptor interactions, analgesic pathways, and the neurochemistry of pleasure and pain.

Product Specifications

CAS Number 60617-12-1
Molecular Weight 3464.9722 Da
Molecular Formula C₁₅₈H₂₅₁N₃₉O₄₆S₁
Purity Peak Area by HPLC ≥95%
Form Lyophilized
Storage -20°C
Usage Research use

Amino Acid Sequence

One-Letter Code:

YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE

Three-Letter Code:

H-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu-OH

Research Applications

  • Application: Receptor binding
  • Biomarker Target: μ-Opioid Receptor (MOR)
  • Research Area: Neuroscience
  • Sub-category: Opioid Signaling & Pain

Reconstitution & Storage

  • Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
  • Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
  • Stability: Lyophilized product is stable for 24 months when stored properly.

For research use only. Not for diagnostic or therapeutic use.

β-Endorphin,human is a 31-amino-acid An endogenous opioid peptide involved in pain modulation, stress response, and reward signaling. Endorphins bind predominantly to μ-opioid receptors (MOR) and play critical roles in analgesia, euphoria, and neuroendocrine regulation.

Safety Data Sheets & Documentation

Safety Data Sheet (SDS) PDF — BPT1558

Protocols & Support

Reconstitution Protocol

1. Briefly centrifuge the vial to collect lyophilized powder at the bottom.

2. Reconstitute in sterile deionized water or PBS to a concentration of 0.2–1.0 mg/mL.

3. Gently pipette up and down to dissolve. Do not vortex.

4. Aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.

Download Data Sheet

Complete product data sheet including batch-specific QC data, sequence information, and storage guidelines.

Download PDF Data Sheet