Name: ACTH (1-39) (guinea pig)
Brand: Boston Molecules
SKU: BPT2273
Price: 412.25 USD
Availability: InStock

ACTH (1-39) (guinea pig)

ACTH (1-39) (guinea pig) is a 39-amino-acid A peptide related to the melanocortin system, derived from proopiomelanocortin (POMC) or its analogs. Melanocortins signal through MC1R-MC5R receptors to regulate pigmentation, inflammation, energy homeostasis, and sexual function. Used in dermatology, endocrinology, and neuroscience research for studying melanocortin receptor pharmacology and POMC processing.

Product Specifications

CAS Number	111524-36-8
Molecular Weight	4529.0428 Da
Molecular Formula	C₂₀₆H₃₀₈N₅₆O₅₈S₁
Purity	Peak Area by HPLC ≥95%
Form	Lyophilized
Storage	-20°C
Usage	Research use

Amino Acid Sequence

One-Letter Code:

SYSMEHFRWGKPVGKKRRPVKVYANGAEEESAEAFPLEF

Three-Letter Code:

H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Ala-Asn-Gly-Ala-Glu-Glu-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH

Research Applications

Application: Receptor binding
Biomarker Target: Melanocortin Receptors (MC1-5R)
Research Area: Endocrinology
Sub-category: Melanocortin System & Pigmentation

Reconstitution & Storage

Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
Stability: Lyophilized product is stable for 24 months when stored properly.

For research use only. Not for diagnostic or therapeutic use.

ACTH (1-39) (guinea pig) is a 39-amino-acid A peptide related to the melanocortin system, derived from proopiomelanocortin (POMC) or its analogs. Melanocortins signal through MC1R-MC5R receptors to regulate pigmentation, inflammation, energy homeostasis, and sexual function.