ACTH (1-39) (mouse, rat)

In Stock · Ships Today
SKU: BPT0104

Price range: $412.25 through $2,473.50

Size
SKU: BPT0104-1MG $412.25
Quality guaranteed
Ships within 24 hours

ACTH (1-39) (mouse, rat)

ACTH (1-39) (mouse, rat) is a 39-amino-acid A peptide related to the melanocortin system, derived from proopiomelanocortin (POMC) or its analogs. Melanocortins signal through MC1R-MC5R receptors to regulate pigmentation, inflammation, energy homeostasis, and sexual function. Used in dermatology, endocrinology, and neuroscience research for studying melanocortin receptor pharmacology and POMC processing.

Product Specifications

CAS Number 77465-10-2
Molecular Weight 4582.1482 Da
Molecular Formula C₂₁₀H₃₁₅N₅₇O₅₇S₁
Purity Peak Area by HPLC ≥95%
Form Lyophilized
Storage -20°C
Usage Research use

Amino Acid Sequence

One-Letter Code:

SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF

Three-Letter Code:

H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Val-Ala-Glu-Asn-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH

Research Applications

  • Application: Receptor binding
  • Biomarker Target: Melanocortin Receptors (MC1-5R)
  • Research Area: Endocrinology
  • Sub-category: Melanocortin System & Pigmentation

Reconstitution & Storage

  • Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
  • Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
  • Stability: Lyophilized product is stable for 24 months when stored properly.

For research use only. Not for diagnostic or therapeutic use.

ACTH (1-39) (mouse, rat) is a 39-amino-acid A peptide related to the melanocortin system, derived from proopiomelanocortin (POMC) or its analogs. Melanocortins signal through MC1R-MC5R receptors to regulate pigmentation, inflammation, energy homeostasis, and sexual function.

Safety Data Sheets & Documentation

Safety Data Sheet (SDS) PDF — BPT0104

Protocols & Support

Reconstitution Protocol

1. Briefly centrifuge the vial to collect lyophilized powder at the bottom.

2. Reconstitute in sterile deionized water or PBS to a concentration of 0.2–1.0 mg/mL.

3. Gently pipette up and down to dissolve. Do not vortex.

4. Aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.

Download Data Sheet

Complete product data sheet including batch-specific QC data, sequence information, and storage guidelines.

Download PDF Data Sheet