ACTH(1-39)
Price range: $76.50 through $459.00
ACTH(1-39)
ACTH(1-39) — A peptide related to the melanocortin system, derived from proopiomelanocortin (POMC) or its analogs. Melanocortins signal through MC1R-MC5R receptors to regulate pigmentation, inflammation, energy homeostasis, and sexual function. Used in dermatology, endocrinology, and neuroscience research for studying melanocortin receptor pharmacology and POMC processing.
Product Specifications
| CAS Number | 12279-41-3 |
| Molecular Weight | 4541.1 Da |
| Molecular Formula | C₂₀₇H₃₀₈N₅₆O₅₈S |
| Purity | Peak Area by HPLC ≥95% |
| Form | Lyophilized |
| Storage | -20°C |
| Usage | Research use |
Amino Acid Sequence
One-Letter Code:
SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Three-Letter Code:
Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe
Research Applications
- Application: Receptor binding
- Biomarker Target: Melanocortin Receptors (MC1-5R)
- Research Area: Endocrinology
- Sub-category: Melanocortin System & Pigmentation
Reconstitution & Storage
- Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
- Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
- Stability: Lyophilized product is stable for 24 months when stored properly.
For research use only. Not for diagnostic or therapeutic use.
Safety Data Sheets & Documentation
Protocols & Support
Reconstitution Protocol
1. Briefly centrifuge the vial to collect lyophilized powder at the bottom.
2. Reconstitute in sterile deionized water or PBS to a concentration of 0.2–1.0 mg/mL.
3. Gently pipette up and down to dissolve. Do not vortex.
4. Aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
Download Data Sheet
Complete product data sheet including batch-specific QC data, sequence information, and storage guidelines.
Download PDF Data Sheet