Name: Adrenomedullin (1- 52), porcine
Brand: Boston Molecules
SKU: BPT2168
Price: 319.60 USD
Availability: InStock

Adrenomedullin (1- 52), porcine

Adrenomedullin (1- 52), porcine is a 75-amino-acid A peptide related to the calcitonin/CGRP superfamily, involved in calcium homeostasis, bone metabolism, vasodilation, and nociception. Used in endocrinology and neuroscience research to study calcitonin receptor (CTR) and CGRP receptor (CLR/RAMP1) signaling, with applications in osteoporosis, migraine, and pain research.

Product Specifications

Molecular Weight	5971.6658 Da
Molecular Formula	C₂₆₂H₄₀₃N₇₉O₇₆S₃
Purity	Peak Area by HPLC ≥95%
Form	Lyophilized
Storage	-20°C
Usage	Research use

Amino Acid Sequence

One-Letter Code:

YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDGVAPRSKISPQGY-NH2(Disulfidebridge:Cys16-Cys21)

Three-Letter Code:

H-Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2(Disulfidebridge:Cys16-Cys21)

Research Applications

Application: Receptor binding
Biomarker Target: Calcitonin/CGRP Receptors
Research Area: Endocrinology
Sub-category: Calcitonin/CGRP & Bone Metabolism

Reconstitution & Storage

Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
Stability: Lyophilized product is stable for 24 months when stored properly.

For research use only. Not for diagnostic or therapeutic use.

Adrenomedullin (1- 52), porcine is a 75-amino-acid A peptide related to the calcitonin/CGRP superfamily, involved in calcium homeostasis, bone metabolism, vasodilation, and nociception. Used in endocrinology and neuroscience research to study calcitonin receptor (CTR) and CGRP receptor (CLR/RAMP1...