AGRP (25-82)

In Stock · Ships Today
SKU: BPT2174

Price range: $319.60 through $1,917.60

Size
SKU: BPT2174-1MG $319.60
Quality guaranteed
Ships within 24 hours

AGRP (25-82)

AGRP (25-82) is a 58-amino-acid A peptide related to the bombesin/gastrin-releasing peptide (GRP) family, which mediates diverse physiological functions including gastrointestinal motility, hormone secretion, cell proliferation, and satiety signaling. This peptide is used in oncology and gastrointestinal research to study GRP receptor (GRPR/BB2) signaling, tumor growth, and the development of targeted diagnostic and therapeutic agents.

Product Specifications

Molecular Weight 6415.2295 Da
Molecular Formula C₂₇₉H₄₆₈N₈₀O₉₀S₁
Purity Peak Area by HPLC ≥95%
Form Lyophilized
Storage -20°C
Usage Research use

Amino Acid Sequence

One-Letter Code:

LAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPR

Three-Letter Code:

H-Leu-Ala-Pro-Met-Glu-Gly-Ile-Arg-Arg-Pro-Asp-Gln-Ala-Leu-Leu-Pro-Glu-Leu-Pro-Gly-Leu-Gly-Leu-Arg-Ala-Pro-Leu-Lys-Lys-Thr-Thr-Ala-Glu-Gln-Ala-Glu-Glu-Asp-Leu-Leu-Gln-Glu-Ala-Gln-Ala-Leu-Ala-Glu-Val-Leu-Asp-Leu-Gln-Asp-Arg-Glu-Pro-Arg-OH

Research Applications

  • Application: Receptor binding
  • Biomarker Target: Bombesin/GRP Receptors (BB1-3)
  • Research Area: Oncology
  • Sub-category: Bombesin/GRP Signaling & Tumor Biology

Reconstitution & Storage

  • Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
  • Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
  • Stability: Lyophilized product is stable for 24 months when stored properly.

For research use only. Not for diagnostic or therapeutic use.

AGRP (25-82) is a 58-amino-acid A peptide related to the bombesin/gastrin-releasing peptide (GRP) family, which mediates diverse physiological functions including gastrointestinal motility, hormone secretion, cell proliferation, and satiety signaling. This peptide is used in oncology and gastroin...

Safety Data Sheets & Documentation

Safety Data Sheet (SDS) PDF — BPT2174

Protocols & Support

Reconstitution Protocol

1. Briefly centrifuge the vial to collect lyophilized powder at the bottom.

2. Reconstitute in sterile deionized water or PBS to a concentration of 0.2–1.0 mg/mL.

3. Gently pipette up and down to dissolve. Do not vortex.

4. Aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.

Download Data Sheet

Complete product data sheet including batch-specific QC data, sequence information, and storage guidelines.

Download PDF Data Sheet