Name: Apelin-36 (human)
Brand: Boston Molecules
SKU: BPT0099
Price: 319.60 USD
Availability: InStock

Apelin-36 (human)

Apelin-36 (human) is a 36-amino-acid A peptide from the apelin/APJ system, an endogenous ligand for the APJ receptor (angiotensin receptor-like 1). Apelin signaling regulates cardiovascular function, fluid homeostasis, angiogenesis, and energy metabolism. Used in cardiovascular and metabolic research for studying heart failure, pulmonary hypertension, and diabetes-related vascular dysfunction.

Product Specifications

CAS Number	252642-12-9
Molecular Weight	4195.8166 Da
Molecular Formula	C₁₈₄H₂₉₇N₆₉O₄₃S₁
Purity	Peak Area by HPLC ≥95%
Form	Lyophilized
Storage	-20°C
Usage	Research use

Amino Acid Sequence

One-Letter Code:

LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF

Three-Letter Code:

H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH

Research Applications

Application: Biological activity
Biomarker Target: Peptide Target
Research Area: Biomedical Research
Sub-category: Research Peptides & Tools

Reconstitution & Storage

Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
Stability: Lyophilized product is stable for 24 months when stored properly.

For research use only. Not for diagnostic or therapeutic use.

Apelin-36 (human) is a 36-amino-acid A peptide from the apelin/APJ system, an endogenous ligand for the APJ receptor (angiotensin receptor-like 1). Apelin signaling regulates cardiovascular function, fluid homeostasis, angiogenesis, and energy metabolism.