Big Endothelin-1 (1-38), human

In Stock · Ships Today
SKU: BPT2614

Price range: $168.30 through $1,009.80

Size
SKU: BPT2614-1MG $168.30
Quality guaranteed
Ships within 24 hours

Big Endothelin-1 (1-38), human

Big Endothelin-1 (1-38), human is a 65-amino-acid A peptide from the endothelin family, one of the most potent vasoconstrictors known. Endothelins signal through ETA and ETB receptors to regulate vascular tone, cell proliferation, and fibrosis. Widely used in cardiovascular, pulmonary, and renal research for studying vasoconstriction, pulmonary hypertension, and the development of endothelin receptor antagonists.

Product Specifications

CAS Number 120796-97-6
Molecular Weight 4282.8631 Da
Molecular Formula C₁₈₉H₂₈₂N₄₈O₅₆S₅
Purity Peak Area by HPLC ≥95%
Form Lyophilized
Storage -20°C
Usage Research use

Amino Acid Sequence

One-Letter Code:

CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS(Disulfidebridge:Cys1-Cys15,Cys3-Cys11)

Three-Letter Code:

H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Val-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Arg-Ser-OH(Disulfidebridge:Cys1-Cys15,Cys3-Cys11)

Research Applications

  • Application: Receptor binding
  • Biomarker Target: Endothelin Receptors (ETA/ETB)
  • Research Area: Cardiovascular
  • Sub-category: Endothelin System & Vasoconstriction

Reconstitution & Storage

  • Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
  • Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
  • Stability: Lyophilized product is stable for 24 months when stored properly.

For research use only. Not for diagnostic or therapeutic use.

Big Endothelin-1 (1-38), human is a 65-amino-acid A peptide from the endothelin family, one of the most potent vasoconstrictors known. Endothelins signal through ETA and ETB receptors to regulate vascular tone, cell proliferation, and fibrosis.

Safety Data Sheets & Documentation

Safety Data Sheet (SDS) PDF — BPT2614

Protocols & Support

Reconstitution Protocol

1. Briefly centrifuge the vial to collect lyophilized powder at the bottom.

2. Reconstitute in sterile deionized water or PBS to a concentration of 0.2–1.0 mg/mL.

3. Gently pipette up and down to dissolve. Do not vortex.

4. Aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.

Download Data Sheet

Complete product data sheet including batch-specific QC data, sequence information, and storage guidelines.

Download PDF Data Sheet