Name: Big Endothelin -1 (1-39), porcine
Brand: Boston Molecules
SKU: BPT2515
Price: 547.20 USD
Availability: InStock

Big Endothelin -1 (1-39), porcine

Big Endothelin -1 (1-39), porcine is a 66-amino-acid A peptide from the endothelin family, one of the most potent vasoconstrictors known. Endothelins signal through ETA and ETB receptors to regulate vascular tone, cell proliferation, and fibrosis. Widely used in cardiovascular, pulmonary, and renal research for studying vasoconstriction, pulmonary hypertension, and the development of endothelin receptor antagonists.

Product Specifications

CAS Number	124932-61-2
Molecular Weight	4383.9667 Da
Molecular Formula	C₁₉₃H₂₈₉N₄₉O₅₈S₅
Purity	Peak Area by HPLC ≥95%
Form	Lyophilized
Storage	-20°C
Usage	Research use

Amino Acid Sequence

One-Letter Code:

CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS(Disulfidebridge:Cys1-Cys15,Cys3-Cys11)

Three-Letter Code:

H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Ile-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Ser-Arg-Ser-OH(Disulfidebridge:Cys1-Cys15,Cys3-Cys11)

Research Applications

Application: Receptor binding
Biomarker Target: Endothelin Receptors (ETA/ETB)
Research Area: Cardiovascular
Sub-category: Endothelin System & Vasoconstriction

Reconstitution & Storage

Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
Stability: Lyophilized product is stable for 24 months when stored properly.

For research use only. Not for diagnostic or therapeutic use.

Big Endothelin -1 (1-39), porcine is a 66-amino-acid A peptide from the endothelin family, one of the most potent vasoconstrictors known. Endothelins signal through ETA and ETB receptors to regulate vascular tone, cell proliferation, and fibrosis.