Charybdotoxin

Name: Charybdotoxin
Brand: Boston Molecules
SKU: BPT2370
Price: 590.40 USD
Availability: InStock

In Stock · Ships Today

SKU: BPT2370

Price range: $590.40 through $3,542.40

Size

SKU: BPT2370-1MG $590.40

Quality guaranteed

Ships within 24 hours

Charybdotoxin

Charybdotoxin is a 72-amino-acid synthetic peptide. A synthetic peptide used as a research tool in biochemistry, pharmacology, and biomedical research. This peptide enables the study of protein-protein interactions, receptor binding, enzyme substrate specificity, and signal transduction pathways. Available in high purity (≥95% by HPLC) as a lyophilized powder for reconstitution in appropriate buffers.

Product Specifications

CAS Number	95751-30-7
Molecular Weight	4295.8754 Da
Molecular Formula	C₁₇₆H₂₇₇N₅₇O₅₅S₇
Purity	Peak Area by HPLC ≥95%
Form	Lyophilized
Storage	-20°C
Usage	Research use

Amino Acid Sequence

One-Letter Code:

{Pyr}FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS(Disulfidebridge:Cys7-Cys28,Cys13-Cys33,Cys17-Cys35)

Three-Letter Code:

H-{Pyr}-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser-OH(Disulfidebridge:Cys7-Cys28,Cys13-Cys33,Cys17-Cys35)

Research Applications

Application: Receptor binding
Biomarker Target: Disulfide-bonded Target
Research Area: Pharmacology
Sub-category: Receptor Ligands & Peptide Drugs

Reconstitution & Storage

Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
Stability: Lyophilized product is stable for 24 months when stored properly.

For research use only. Not for diagnostic or therapeutic use.

Charybdotoxin is a 72-amino-acid synthetic peptide. A synthetic peptide used as a research tool in biochemistry, pharmacology, and biomedical research.