[Des-Tyr1]-β-Endorphin, human
Price range: $272.00 through $1,632.00
[Des-Tyr1]-β-Endorphin, human
[Des-Tyr1]-β-Endorphin, human is a 30-amino-acid An endogenous opioid peptide involved in pain modulation, stress response, and reward signaling. Endorphins bind predominantly to μ-opioid receptors (MOR) and play critical roles in analgesia, euphoria, and neuroendocrine regulation. Used in neuroscience and pharmacology research for studying opioid receptor interactions, analgesic pathways, and the neurochemistry of pleasure and pain.
Product Specifications
| Molecular Weight | 3301.7993 Da |
| Molecular Formula | C₁₄₉H₂₄₂N₃₈O₄₄S₁ |
| Purity | Peak Area by HPLC ≥95% |
| Form | Lyophilized |
| Storage | -20°C |
| Usage | Research use |
Amino Acid Sequence
One-Letter Code:
GGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
Three-Letter Code:
H-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu-OH
Research Applications
- Application: Receptor binding
- Biomarker Target: μ-Opioid Receptor (MOR)
- Research Area: Neuroscience
- Sub-category: Opioid Signaling & Pain
Reconstitution & Storage
- Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
- Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
- Stability: Lyophilized product is stable for 24 months when stored properly.
For research use only. Not for diagnostic or therapeutic use.
Safety Data Sheets & Documentation
Protocols & Support
Reconstitution Protocol
1. Briefly centrifuge the vial to collect lyophilized powder at the bottom.
2. Reconstitute in sterile deionized water or PBS to a concentration of 0.2–1.0 mg/mL.
3. Gently pipette up and down to dissolve. Do not vortex.
4. Aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
Download Data Sheet
Complete product data sheet including batch-specific QC data, sequence information, and storage guidelines.
Download PDF Data Sheet