Name: Exendin 3
Brand: Boston Molecules
SKU: BPT1589
Price: 315.00 USD
Availability: InStock

Exendin 3

Exendin 3 is a 41-amino-acid A peptide related to the incretin/glucagon family, involved in glucose homeostasis, insulin secretion, and metabolic regulation. These peptides signal through GLP-1R, GIPR, or glucagon receptors and are central to diabetes and obesity research. Used for studying incretin-based therapeutics, β-cell function, and metabolic signaling pathways.

Product Specifications

CAS Number	130357-25-4
Molecular Weight	4202.56 Da
Molecular Formula	C₁₈₄H₂₈₂N₅₀O₆₁S₁
Purity	Peak Area by HPLC ≥95%
Form	Lyophilized
Storage	-20°C
Usage	Research use

Amino Acid Sequence

One-Letter Code:

HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Three-Letter Code:

H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2

Research Applications

Application: Receptor binding
Biomarker Target: GLP-1R / GIPR / GcgR
Research Area: Metabolic Disease
Sub-category: Incretin System & Diabetes

Reconstitution & Storage

Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
Stability: Lyophilized product is stable for 24 months when stored properly.

For research use only. Not for diagnostic or therapeutic use.

Exendin 3 is a 41-amino-acid A peptide related to the incretin/glucagon family, involved in glucose homeostasis, insulin secretion, and metabolic regulation. These peptides signal through GLP-1R, GIPR, or glucagon receptors and are central to diabetes and obesity research.