Fibronectin-Binding Protein

Name: Fibronectin-Binding Protein
Brand: Boston Molecules
SKU: BPT2634
Price: 360.00 USD
Availability: InStock

In Stock · Ships Today

SKU: BPT2634

Price range: $360.00 through $2,160.00

Size

SKU: BPT2634-1MG $360.00

Quality guaranteed

Ships within 24 hours

Fibronectin-Binding Protein

Fibronectin-Binding Protein is a 37-amino-acid synthetic peptide. A synthetic peptide used as a research tool in biochemistry, pharmacology, and biomedical research. This peptide enables the study of protein-protein interactions, receptor binding, enzyme substrate specificity, and signal transduction pathways. Available in high purity (≥95% by HPLC) as a lyophilized powder for reconstitution in appropriate buffers.

Product Specifications

Molecular Weight	4309.5574 Da
Molecular Formula	C₁₉₀H₂₈₃N₄₉O₆₆
Purity	Peak Area by HPLC ≥95%
Form	Lyophilized
Storage	-20°C
Usage	Research use

Amino Acid Sequence

One-Letter Code:

FNKHTEIIEEDTNKDKPSYQFGGHNSVDFEEDTLPKV

Three-Letter Code:

H-Phe-Asn-Lys-His-Thr-Glu-Ile-Ile-Glu-Glu-Asp-Thr-Asn-Lys-Asp-Lys-Pro-Ser-Tyr-Gln-Phe-Gly-Gly-His-Asn-Ser-Val-Asp-Phe-Glu-Glu-Asp-Thr-Leu-Pro-Lys-Val-OH

Research Applications

Application: Cell adhesion
Biomarker Target: Integrin Receptors (αvβ3, α5β1)
Research Area: Cell Biology
Sub-category: Integrin Signaling & Cell Adhesion

Reconstitution & Storage

Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
Stability: Lyophilized product is stable for 24 months when stored properly.

For research use only. Not for diagnostic or therapeutic use.

Fibronectin-Binding Protein is a 37-amino-acid synthetic peptide. A synthetic peptide used as a research tool in biochemistry, pharmacology, and biomedical research.