Galanin-Lys(Biotin), human
Price range: $272.00 through $1,632.00
Galanin-Lys(Biotin), human
Galanin-Lys(Biotin), human is a 39-amino-acid A peptide from the galanin family, a neuropeptide widely expressed in the central and peripheral nervous systems. Galanin modulates neurotransmitter release (including acetylcholine, serotonin, and norepinephrine) through GalR1, GalR2, and GalR3 receptors, influencing cognition, pain, feeding, mood, and neuroendocrine function. Used in neuroscience research for studying neuropeptide signaling, Alzheimer’s disease, epilepsy, and depression.
Product Specifications
| Molecular Weight | 3511.8685 Da |
| Molecular Formula | C₁₅₅H₂₃₆N₄₆O₄₆S₁ |
| Purity | Peak Area by HPLC ≥95% |
| Form | Lyophilized |
| Storage | -20°C |
| Usage | Research use |
Amino Acid Sequence
One-Letter Code:
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS{Lys(Biotin)}
Three-Letter Code:
H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-{Lys(Biotin)}-OH
Research Applications
- Application: Receptor binding
- Biomarker Target: Galanin Receptors (GalR1-3)
- Research Area: Neuroscience
- Sub-category: Galanin & Neuromodulation
Reconstitution & Storage
- Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
- Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
- Stability: Lyophilized product is stable for 24 months when stored properly.
For research use only. Not for diagnostic or therapeutic use.
Safety Data Sheets & Documentation
Protocols & Support
Reconstitution Protocol
1. Briefly centrifuge the vial to collect lyophilized powder at the bottom.
2. Reconstitute in sterile deionized water or PBS to a concentration of 0.2–1.0 mg/mL.
3. Gently pipette up and down to dissolve. Do not vortex.
4. Aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
Download Data Sheet
Complete product data sheet including batch-specific QC data, sequence information, and storage guidelines.
Download PDF Data Sheet