Name: GIP (1-30), porcine, amide
Brand: Boston Molecules
SKU: BPT1738
Price: 315.00 USD
Availability: InStock

GIP (1-30), porcine, amide

GIP (1-30), porcine, amide is a 32-amino-acid A peptide related to the incretin/glucagon family, involved in glucose homeostasis, insulin secretion, and metabolic regulation. These peptides signal through GLP-1R, GIPR, or glucagon receptors and are central to diabetes and obesity research. Used for studying incretin-based therapeutics, β-cell function, and metabolic signaling pathways.

Product Specifications

CAS Number	134846-93-8
Molecular Weight	3550.9804 Da
Molecular Formula	C₁₆₂H₂₄₅N₄₁O₄₇S₁
Purity	Peak Area by HPLC ≥95%
Form	Lyophilized
Storage	-20°C
Usage	Research use

Amino Acid Sequence

One-Letter Code:

YAEGTFISDYSIAMDKIRQQDFVNWLLAQK-NH2

Three-Letter Code:

H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH2

Research Applications

Application: Receptor binding
Biomarker Target: GLP-1R / GIPR / GcgR
Research Area: Metabolic Disease
Sub-category: Incretin System & Diabetes

Reconstitution & Storage

Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
Stability: Lyophilized product is stable for 24 months when stored properly.

For research use only. Not for diagnostic or therapeutic use.

GIP (1-30), porcine, amide is a 32-amino-acid A peptide related to the incretin/glucagon family, involved in glucose homeostasis, insulin secretion, and metabolic regulation. These peptides signal through GLP-1R, GIPR, or glucagon receptors and are central to diabetes and obesity research.