GIP, porcine
$315.00 – $1,890.00Price range: $315.00 through $1,890.00
GIP, porcine
GIP, porcine is a 42-amino-acid A peptide related to the incretin/glucagon family, involved in glucose homeostasis, insulin secretion, and metabolic regulation. These peptides signal through GLP-1R, GIPR, or glucagon receptors and are central to diabetes and obesity research. Used for studying incretin-based therapeutics, β-cell function, and metabolic signaling pathways.
Product Specifications
| Molecular Weight | 4975.5367 Da |
| Molecular Formula | C₂₂₅H₃₄₂N₆₀O₆₆S₁ |
| Purity | Peak Area by HPLC ≥95% |
| Form | Lyophilized |
| Storage | -20°C |
| Usage | Research use |
Amino Acid Sequence
One-Letter Code:
YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ
Three-Letter Code:
H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH
Research Applications
- Application: Receptor binding
- Biomarker Target: GLP-1R / GIPR / GcgR
- Research Area: Metabolic Disease
- Sub-category: Incretin System & Diabetes
Reconstitution & Storage
- Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
- Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
- Stability: Lyophilized product is stable for 24 months when stored properly.
For research use only. Not for diagnostic or therapeutic use.
Safety Data Sheets & Documentation
Protocols & Support
Reconstitution Protocol
1. Briefly centrifuge the vial to collect lyophilized powder at the bottom.
2. Reconstitute in sterile deionized water or PBS to a concentration of 0.2–1.0 mg/mL.
3. Gently pipette up and down to dissolve. Do not vortex.
4. Aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
Download Data Sheet
Complete product data sheet including batch-specific QC data, sequence information, and storage guidelines.
Download PDF Data Sheet