[Gln22]-β-Amyloid (1-40)

[Gln22]-β-Amyloid (1-40)

[Gln22]-β-Amyloid (1-40) is a 40-amino-acid A synthetic peptide fragment of the amyloid β-protein (Aβ), a 39–43 amino acid peptide that is the principal component of amyloid plaques in Alzheimer’s disease. This fragment is widely used in neuroscience research to study Aβ aggregation, neurotoxicity, and the molecular mechanisms underlying Alzheimer’s pathology. It serves as a valuable tool for investigating amyloid fibril formation, screening potential therapeutic agents, and elucidating structure-activity relationships within the Aβ sequence.

Product Specifications

Amino Acid Sequence

One-Letter Code:

DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV

Three-Letter Code:

H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH

Research Applications

• Application: Neurotoxicity & Aggregation
• Biomarker Target: Amyloid-β / Tau
• Research Area: Neuroscience
• Sub-category: Neurodegeneration & Alzheimer’s Disease

Reconstitution & Storage

• Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
• Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Lyophilized product is stable for 24 months when stored properly.

For research use only. Not for diagnostic or therapeutic use.

Safety Data Sheets & Documentation

Protocols & Support