Name: GLP-1 (7-36) amide (chicken, common turkey)
Brand: Boston Molecules
SKU: BPT1723
Price: 367.20 USD
Availability: InStock

GLP-1 (7-36) amide (chicken, common turkey)

GLP-1 (7-36) amide (chicken, common turkey) is a 32-amino-acid A peptide related to the incretin/glucagon family, involved in glucose homeostasis, insulin secretion, and metabolic regulation. These peptides signal through GLP-1R, GIPR, or glucagon receptors and are central to diabetes and obesity research. Used for studying incretin-based therapeutics, β-cell function, and metabolic signaling pathways.

Product Specifications

CAS Number	1802078-26-7
Molecular Weight	3327.6037 Da
Molecular Formula	C₁₄₉H₂₂₄N₄₀O₄₇
Purity	Peak Area by HPLC ≥95%
Form	Lyophilized
Storage	-20°C
Usage	Research use

Amino Acid Sequence

One-Letter Code:

HAEGTYTSDITSYLEGQAAKEFIAWLVNGR-NH2

Three-Letter Code:

H-His-Ala-Glu-Gly-Thr-Tyr-Thr-Ser-Asp-Ile-Thr-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Asn-Gly-Arg-NH2

Research Applications

Application: Receptor binding
Biomarker Target: GLP-1R / GIPR / GcgR
Research Area: Metabolic Disease
Sub-category: Incretin System & Diabetes

Reconstitution & Storage

Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
Stability: Lyophilized product is stable for 24 months when stored properly.

For research use only. Not for diagnostic or therapeutic use.

GLP-1 (7-36) amide (chicken, common turkey) is a 32-amino-acid A peptide related to the incretin/glucagon family, involved in glucose homeostasis, insulin secretion, and metabolic regulation. These peptides signal through GLP-1R, GIPR, or glucagon receptors and are central to diabetes and obesity...