GLP-2(1-33)(human)
Price range: $315.00 through $1,890.00
GLP-2(1-33)(human)
GLP-2(1-33)(human) is a 33-amino-acid A peptide related to the incretin/glucagon family, involved in glucose homeostasis, insulin secretion, and metabolic regulation. These peptides signal through GLP-1R, GIPR, or glucagon receptors and are central to diabetes and obesity research. Used for studying incretin-based therapeutics, β-cell function, and metabolic signaling pathways.
Product Specifications
| CAS Number | 223460-79-5 |
| Molecular Weight | 3766.0989 Da |
| Molecular Formula | C₁₆₅H₂₅₄N₄₄O₅₅S₁ |
| Purity | Peak Area by HPLC ≥95% |
| Form | Lyophilized |
| Storage | -20°C |
| Usage | Research use |
Amino Acid Sequence
One-Letter Code:
HADGSFSDEMNTILDNLAARDFINWLIQTKITD
Three-Letter Code:
H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH
Research Applications
- Application: Biological activity
- Biomarker Target: Peptide Target
- Research Area: Biomedical Research
- Sub-category: Research Peptides & Tools
Reconstitution & Storage
- Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
- Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
- Stability: Lyophilized product is stable for 24 months when stored properly.
For research use only. Not for diagnostic or therapeutic use.
Safety Data Sheets & Documentation
Protocols & Support
Reconstitution Protocol
1. Briefly centrifuge the vial to collect lyophilized powder at the bottom.
2. Reconstitute in sterile deionized water or PBS to a concentration of 0.2–1.0 mg/mL.
3. Gently pipette up and down to dissolve. Do not vortex.
4. Aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
Download Data Sheet
Complete product data sheet including batch-specific QC data, sequence information, and storage guidelines.
Download PDF Data Sheet