Kaliotoxin

In Stock · Ships Today
SKU: BPT0163

Price range: $583.20 through $3,499.20

Size
SKU: BPT0163-1MG $583.20
Quality guaranteed
Ships within 24 hours

Kaliotoxin

Kaliotoxin is a 71-amino-acid synthetic peptide. A synthetic peptide used as a research tool in biochemistry, pharmacology, and biomedical research. This peptide enables the study of protein-protein interactions, receptor binding, enzyme substrate specificity, and signal transduction pathways. Available in high purity (≥95% by HPLC) as a lyophilized powder for reconstitution in appropriate buffers.

Product Specifications

CAS Number 145199-73-1
Molecular Weight 4149.9245 Da
Molecular Formula C₁₇₁H₂₈₃N₅₅O₄₉S₈
Purity Peak Area by HPLC ≥95%
Form Lyophilized
Storage -20°C
Usage Research use

Amino Acid Sequence

One-Letter Code:

GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK(Disulfidebridge:Cys8-Cys28,Cys14-Cys33,Cys18-Cys35)

Three-Letter Code:

H-Gly-Val-Glu-Ile-Asn-Val-Lys-Cys-Ser-Gly-Ser-Pro-Gln-Cys-Leu-Lys-Pro-Cys-Lys-Asp-Ala-Gly-Met-Arg-Phe-Gly-Lys-Cys-Met-Asn-Arg-Lys-Cys-His-Cys-Thr-Pro-Lys-OH(Disulfidebridge:Cys8-Cys28,Cys14-Cys33,Cys18-Cys35)

Research Applications

  • Application: Receptor binding
  • Biomarker Target: Disulfide-bonded Target
  • Research Area: Pharmacology
  • Sub-category: Receptor Ligands & Peptide Drugs

Reconstitution & Storage

  • Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
  • Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
  • Stability: Lyophilized product is stable for 24 months when stored properly.

For research use only. Not for diagnostic or therapeutic use.

Kaliotoxin is a 71-amino-acid synthetic peptide. A synthetic peptide used as a research tool in biochemistry, pharmacology, and biomedical research.

Safety Data Sheets & Documentation

Safety Data Sheet (SDS) PDF — BPT0163

Protocols & Support

Reconstitution Protocol

1. Briefly centrifuge the vial to collect lyophilized powder at the bottom.

2. Reconstitute in sterile deionized water or PBS to a concentration of 0.2–1.0 mg/mL.

3. Gently pipette up and down to dissolve. Do not vortex.

4. Aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.

Download Data Sheet

Complete product data sheet including batch-specific QC data, sequence information, and storage guidelines.

Download PDF Data Sheet