LL-37 (scrambled) /Cationic Antimicrobial Protein 18 (134-170) (Scrambled) (human), hCAP-18 (134-170)

In Stock · Ships Today
SKU: BPT0080

Price range: $209.95 through $1,259.70

Size
SKU: BPT0080-1MG $209.95
Quality guaranteed
Ships within 24 hours

LL-37 (scrambled) /Cationic Antimicrobial Protein 18 (134-170) (Scrambled) (human), hCAP-18 (134-170)

LL-37 (scrambled) /Cationic Antimicrobial Protein 18 (134-170) (Scrambled) (human), hCAP-18 (134-170) is a 37-amino-acid A peptide related to the cathelicidin/LL-37 family of host defense peptides (antimicrobial peptides, AMPs). These peptides exhibit broad-spectrum antimicrobial activity against bacteria, fungi, and viruses, and modulate innate immune responses including chemotaxis, cytokine production, and wound healing. Used in infectious disease and immunology research for studying antimicrobial mechanisms and immune modulation.

Product Specifications

CAS Number 1354065-56-7
Molecular Weight 4493.2497 Da
Molecular Formula C₂₀₅H₃₄₀N₆₀O₅₃
Purity Peak Area by HPLC ≥95%
Form Lyophilized
Storage -20°C
Usage Research use

Amino Acid Sequence

One-Letter Code:

GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR

Three-Letter Code:

H-Gly-Leu-Lys-Leu-Arg-Phe-Glu-Phe-Ser-Lys-Ile-Lys-Gly-Glu-Phe-Leu-Lys-Thr-Pro-Glu-Val-Arg-Phe-Arg-Asp-Ile-Lys-Leu-Lys-Asp-Asn-Arg-Ile-Ser-Val-Gln-Arg-OH

Research Applications

  • Application: Antimicrobial activity
  • Biomarker Target: Host Defense Peptide
  • Research Area: Immunology
  • Sub-category: Antimicrobial Peptides & Innate Immunity

Reconstitution & Storage

  • Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
  • Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
  • Stability: Lyophilized product is stable for 24 months when stored properly.

For research use only. Not for diagnostic or therapeutic use.

LL-37 (scrambled) /Cationic Antimicrobial Protein 18 (134-170) (Scrambled) (human), hCAP-18 (134-170) is a 37-amino-acid A peptide related to the cathelicidin/LL-37 family of host defense peptides (antimicrobial peptides, AMPs). These peptides exhibit broad-spectrum antimicrobial activity against...

Safety Data Sheets & Documentation

Safety Data Sheet (SDS) PDF — BPT0080

Protocols & Support

Reconstitution Protocol

1. Briefly centrifuge the vial to collect lyophilized powder at the bottom.

2. Reconstitute in sterile deionized water or PBS to a concentration of 0.2–1.0 mg/mL.

3. Gently pipette up and down to dissolve. Do not vortex.

4. Aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.

Download Data Sheet

Complete product data sheet including batch-specific QC data, sequence information, and storage guidelines.

Download PDF Data Sheet