Name: PACAP (1-27), human, ovine, rat TFA
Brand: Boston Molecules
SKU: BPT0928
Price: 319.60 USD
Availability: InStock

PACAP (1-27), human, ovine, rat TFA

PACAP (1-27), human, ovine, rat TFA is a 29-amino-acid A peptide related to the vasoactive intestinal peptide (VIP) / PACAP family, a 28-amino-acid neuropeptide that signals through VPAC1 and VPAC2 receptors. VIP mediates vasodilation, smooth muscle relaxation, exocrine secretion, immune modulation, and circadian rhythm regulation. Used in immunology, neuroscience, and gastrointestinal research.

Product Specifications

Molecular Weight	3147.5986 Da
Molecular Formula	C₁₄₂H₂₂₄N₄₀O₃₉S₁
Purity	Peak Area by HPLC ≥95%
Form	Lyophilized
Storage	-20°C
Usage	Research use

Amino Acid Sequence

One-Letter Code:

HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2

Three-Letter Code:

H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2

Research Applications

Application: Receptor binding
Biomarker Target: VIP/PACAP Receptors (VPAC1/2)
Research Area: Neuroscience
Sub-category: VIP/PACAP Signaling

Reconstitution & Storage

Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
Stability: Lyophilized product is stable for 24 months when stored properly.

For research use only. Not for diagnostic or therapeutic use.

PACAP (1-27), human, ovine, rat TFA is a 29-amino-acid A peptide related to the vasoactive intestinal peptide (VIP) / PACAP family, a 28-amino-acid neuropeptide that signals through VPAC1 and VPAC2 receptors. VIP mediates vasodilation, smooth muscle relaxation, exocrine secretion, immune modulati...