Name: Pramlintide Acetate
Brand: Boston Molecules
SKU: BPT2744
Price: 135.00 USD
Availability: InStock

Pramlintide Acetate

Pramlintide Acetate — A synthetic peptide used as a research tool in biochemistry, pharmacology, and biomedical research. This peptide enables the study of protein-protein interactions, receptor binding, enzyme substrate specificity, and signal transduction pathways. Available in high purity (≥95% by HPLC) as a lyophilized powder for reconstitution in appropriate buffers.

Product Specifications

CAS Number	196078-30-5/151126-32-8
Molecular Weight	3949.47 Da
Molecular Formula	C171H267N51O53S2
Purity	Peak Area by HPLC ≥95%
Form	Lyophilized
Storage	-20°C
Usage	Research use

Amino Acid Sequence

One-Letter Code:

KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH₂

Three-Letter Code:

Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH₂

Research Applications

Application: Receptor binding
Biomarker Target: Calcitonin/CGRP Receptors
Research Area: Endocrinology
Sub-category: Calcitonin/CGRP & Bone Metabolism

Reconstitution & Storage

Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
Stability: Lyophilized product is stable for 24 months when stored properly.

For research use only. Not for diagnostic or therapeutic use.

Pramlintide Acetate — A synthetic peptide used as a research tool in biochemistry, pharmacology, and biomedical research. This peptide enables the study of protein-protein interactions, receptor binding, enzyme substrate specificity, and signal transduction pathways.