VIP, guinea pig
Price range: $93.50 through $561.00
VIP, guinea pig
VIP, guinea pig is a 30-amino-acid A peptide related to the vasoactive intestinal peptide (VIP) / PACAP family, a 28-amino-acid neuropeptide that signals through VPAC1 and VPAC2 receptors. VIP mediates vasodilation, smooth muscle relaxation, exocrine secretion, immune modulation, and circadian rhythm regulation. Used in immunology, neuroscience, and gastrointestinal research.
Product Specifications
| CAS Number | 96886-24-7 |
| Molecular Weight | 3344.8539 Da |
| Molecular Formula | C₁₄₇H₂₃₉N₄₃O₄₂S₂ |
| Purity | Peak Area by HPLC ≥95% |
| Form | Lyophilized |
| Storage | -20°C |
| Usage | Research use |
Amino Acid Sequence
One-Letter Code:
HSDALFTDTYTRLRKQMAMKKYLNSVLN-NH2
Three-Letter Code:
H-His-Ser-Asp-Ala-Leu-Phe-Thr-Asp-Thr-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Met-Lys-Lys-Tyr-Leu-Asn-Ser-Val-Leu-Asn-NH2
Research Applications
- Application: Receptor binding
- Biomarker Target: VIP/PACAP Receptors (VPAC1/2)
- Research Area: Neuroscience
- Sub-category: VIP/PACAP Signaling
Reconstitution & Storage
- Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
- Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
- Stability: Lyophilized product is stable for 24 months when stored properly.
For research use only. Not for diagnostic or therapeutic use.
Safety Data Sheets & Documentation
Protocols & Support
Reconstitution Protocol
1. Briefly centrifuge the vial to collect lyophilized powder at the bottom.
2. Reconstitute in sterile deionized water or PBS to a concentration of 0.2–1.0 mg/mL.
3. Gently pipette up and down to dissolve. Do not vortex.
4. Aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
Download Data Sheet
Complete product data sheet including batch-specific QC data, sequence information, and storage guidelines.
Download PDF Data Sheet