Galanin, human

In Stock · Ships Today
SKU: BPT1897

Price range: $272.00 through $1,632.00

Size
SKU: BPT1897-1MG $272.00
Quality guaranteed
Ships within 24 hours

Galanin, human

Galanin, human is a 30-amino-acid A peptide from the galanin family, a neuropeptide widely expressed in the central and peripheral nervous systems. Galanin modulates neurotransmitter release (including acetylcholine, serotonin, and norepinephrine) through GalR1, GalR2, and GalR3 receptors, influencing cognition, pain, feeding, mood, and neuroendocrine function. Used in neuroscience research for studying neuropeptide signaling, Alzheimer’s disease, epilepsy, and depression.

Product Specifications

CAS Number 119418-04-1
Molecular Weight 3157.4019 Da
Molecular Formula C₁₃₉H₂₁₀N₄₂O₄₃
Purity Peak Area by HPLC ≥95%
Form Lyophilized
Storage -20°C
Usage Research use

Amino Acid Sequence

One-Letter Code:

GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS

Three-Letter Code:

H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-OH

Research Applications

  • Application: Receptor binding
  • Biomarker Target: Galanin Receptors (GalR1-3)
  • Research Area: Neuroscience
  • Sub-category: Galanin & Neuromodulation

Reconstitution & Storage

  • Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
  • Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
  • Stability: Lyophilized product is stable for 24 months when stored properly.

For research use only. Not for diagnostic or therapeutic use.

Galanin, human is a 30-amino-acid A peptide from the galanin family, a neuropeptide widely expressed in the central and peripheral nervous systems. Galanin modulates neurotransmitter release (including acetylcholine, serotonin, and norepinephrine) through GalR1, GalR2, and GalR3 receptors, influe...

Safety Data Sheets & Documentation

Safety Data Sheet (SDS) PDF — BPT1897

Protocols & Support

Reconstitution Protocol

1. Briefly centrifuge the vial to collect lyophilized powder at the bottom.

2. Reconstitute in sterile deionized water or PBS to a concentration of 0.2–1.0 mg/mL.

3. Gently pipette up and down to dissolve. Do not vortex.

4. Aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.

Download Data Sheet

Complete product data sheet including batch-specific QC data, sequence information, and storage guidelines.

Download PDF Data Sheet