[Gln11]-β-Amyloid (1-40)
Price range: $150.45 through $902.70
[Gln11]-β-Amyloid (1-40)
[Gln11]-β-Amyloid (1-40) is a 40-amino-acid A synthetic peptide fragment of the amyloid β-protein (Aβ), a 39–43 amino acid peptide that is the principal component of amyloid plaques in Alzheimer’s disease. This fragment is widely used in neuroscience research to study Aβ aggregation, neurotoxicity, and the molecular mechanisms underlying Alzheimer’s pathology. It serves as a valuable tool for investigating amyloid fibril formation, screening potential therapeutic agents, and elucidating structure-activity relationships within the Aβ sequence.
Product Specifications
| Molecular Weight | 4328.8068 Da |
| Molecular Formula | C₁₉₄H₂₉₆N₅₄O₅₇S₁ |
| Purity | Peak Area by HPLC ≥95% |
| Form | Lyophilized |
| Storage | -20°C |
| Usage | Research use |
Amino Acid Sequence
One-Letter Code:
DAEFRHDSGYQVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Three-Letter Code:
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Gln-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
Research Applications
- Application: Neurotoxicity & Aggregation
- Biomarker Target: Amyloid-β / Tau
- Research Area: Neuroscience
- Sub-category: Neurodegeneration & Alzheimer’s Disease
Reconstitution & Storage
- Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
- Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
- Stability: Lyophilized product is stable for 24 months when stored properly.
For research use only. Not for diagnostic or therapeutic use.
Safety Data Sheets & Documentation
Protocols & Support
Reconstitution Protocol
1. Briefly centrifuge the vial to collect lyophilized powder at the bottom.
2. Reconstitute in sterile deionized water or PBS to a concentration of 0.2–1.0 mg/mL.
3. Gently pipette up and down to dissolve. Do not vortex.
4. Aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
Download Data Sheet
Complete product data sheet including batch-specific QC data, sequence information, and storage guidelines.
Download PDF Data Sheet