Peptide YY (canine,mouse,porcine,rat)
Price range: $178.50 through $1,071.00
Peptide YY (canine,mouse,porcine,rat)
Peptide YY (canine,mouse,porcine,rat) is a 38-amino-acid A peptide from the neuropeptide Y (NPY) family, one of the most abundant neuropeptides in the brain. NPY signals through Y1-Y5 receptors to regulate appetite, energy balance, anxiety, circadian rhythms, and cardiovascular function. Used in neuroscience, metabolic, and cardiovascular research for studying feeding behavior, stress responses, and sympathetic nervous system regulation.
Product Specifications
| CAS Number | 81858-94-8 |
| Molecular Weight | 4240.6358 Da |
| Molecular Formula | C₁₉₀H₂₈₈N₅₄O₅₇ |
| Purity | Peak Area by HPLC ≥95% |
| Form | Lyophilized |
| Storage | -20°C |
| Usage | Research use |
Amino Acid Sequence
One-Letter Code:
YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2
Three-Letter Code:
H-Tyr-Pro-Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
Research Applications
- Application: Receptor binding
- Biomarker Target: NPY Receptors (Y1-Y5)
- Research Area: Neuroscience
- Sub-category: Neuropeptide Y & Energy Metabolism
Reconstitution & Storage
- Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
- Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
- Stability: Lyophilized product is stable for 24 months when stored properly.
For research use only. Not for diagnostic or therapeutic use.
Safety Data Sheets & Documentation
Protocols & Support
Reconstitution Protocol
1. Briefly centrifuge the vial to collect lyophilized powder at the bottom.
2. Reconstitute in sterile deionized water or PBS to a concentration of 0.2–1.0 mg/mL.
3. Gently pipette up and down to dissolve. Do not vortex.
4. Aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
Download Data Sheet
Complete product data sheet including batch-specific QC data, sequence information, and storage guidelines.
Download PDF Data Sheet