Parathyroid Hormone (1-38), human

Name: Parathyroid Hormone (1-38), human
Brand: Boston Molecules
SKU: BPT0781
Price: 319.60 USD
Availability: InStock

In Stock · Ships Today

SKU: BPT0781

Price range: $319.60 through $1,917.60

Size

SKU: BPT0781-1MG $319.60

Quality guaranteed

Ships within 24 hours

Parathyroid Hormone (1-38), human

Parathyroid Hormone (1-38), human is a 38-amino-acid synthetic peptide. A synthetic peptide used as a research tool in biochemistry, pharmacology, and biomedical research. This peptide enables the study of protein-protein interactions, receptor binding, enzyme substrate specificity, and signal transduction pathways. Available in high purity (≥95% by HPLC) as a lyophilized powder for reconstitution in appropriate buffers.

Product Specifications

CAS Number	104218-12-4
Molecular Weight	4458.1203 Da
Molecular Formula	C₁₉₇H₃₁₉N₅₉O₅₅S₂
Purity	Peak Area by HPLC ≥95%
Form	Lyophilized
Storage	-20°C
Usage	Research use

Amino Acid Sequence

One-Letter Code:

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG

Three-Letter Code:

H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-Gly-OH

Research Applications

Application: Receptor binding
Biomarker Target: PTH Receptor (PTH1R)
Research Area: Endocrinology
Sub-category: Parathyroid Hormone & Bone Metabolism

Reconstitution & Storage

Reconstitution: Reconstitute in sterile water or appropriate buffer to desired concentration.
Storage: Store lyophilized product at -20°C. After reconstitution, aliquot and store at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
Stability: Lyophilized product is stable for 24 months when stored properly.

For research use only. Not for diagnostic or therapeutic use.

Parathyroid Hormone (1-38), human is a 38-amino-acid synthetic peptide. A synthetic peptide used as a research tool in biochemistry, pharmacology, and biomedical research.